DPCstruct | MC52662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 136 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1IV28 | 1-134 | ANTLREQGVEVLLLTDLLTQTLDIAEAKAWLLETQISDYRLGPTFAADVRGWLADMPHRELARRLSGGLTYGEIPAAIKNMVVDTHT… |
| A0A7Z7D3T4 | 63-201 | AELKANDINVVELTDLVAETYDLASQEAKDKLIEEFLEDSEPVLSEEHKVVVRNFLKSKKTSRELVEIMMAGITKYDLGIEADHELI… |
| A0A090P4Q5 | 42-166 | None |
| A0A377MA78 | 1-127 | None |
| X8DNB1 | 59-203 | None |
| A0A7I8CUW8 | 55-209 | None |
| A0A6I1ZD37 | 15-142 | None |
| A0A2Z5QQM6 | 41-188 | None |
| W4U514 | 1-138 | None |
| A0A1Q9TBF0 | 13-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.