DPCstruct | MC52661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 132 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833KNU3 | 72-183 | ELVNHLGVNLGSTPEEILTRLEKQQYQAVDILDDNEKQASDHRYAHDVTQVDEDTPARFNADPSRLFEASGSAGKVCVFAVRLDTYE… |
| A0A6I1IP59 | 23-155 | QAVDILDDNEKQASDHRYAHDVTQVDEDTPARFNADPSRLFEASGSAGKVCVFAVRLDTYEKVESSVFYIGSNDADDLTAIRRYLLT… |
| A0A378N6P0 | 2-128 | None |
| A0A7U6KN58 | 7-133 | None |
| A0A2D5R966 | 72-217 | None |
| A0A6M1CMW5 | 1-124 | None |
| A0A0A2VUN8 | 138-285 | None |
| A0A376J4Z0 | 84-210 | None |
| A0A7V8FD07 | 585-726 | None |
| A0A447N7P5 | 6-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.