DPCstruct | MC5266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3JCF9 | 1-76 | MTVIDAWNGERAGRLQAALRMSNEEFAEHLGLAPRTVAGWHQNPGTRPRPDVQRMLDAAVQRADDGARQRFAHAMR |
| A0A109IN39 | 56-133 | VVVGRWTEREVRALREALRMTVHDFAQRLGASDAAVSGWEHRRTPTPPKMAAQAVLDQTLALADTDTKARFLLILNTP |
| A0A0P7CHI0 | 4-90 | None |
| A0A6H9X2K2 | 1-77 | None |
| A0A6N7GG22 | 3-92 | None |
| A0A563EHX1 | 2-98 | None |
| A0A372FQK8 | 1-97 | None |
| A0A316IFN6 | 1-82 | None |
| A0A2V2PVV4 | 4-79 | None |
| A0A6V8KRK5 | 9-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.