DPCstruct | MC5265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10823 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830FL15 | 6-114 | PSVSVALAARFLLELGALAALGYWGWVAGDTVASRAVLAAGAPLAAAVVWGAFVAPRARYRLADPARLLVELAVFGAATAGLSLAVS… |
| A0A2U1EKK8 | 22-129 | PVRTTALLVRLLLELALFAGAGYVGWTLSDGGWRILFVVLAPATVIAIWGTLLSPKARVTIPPSARVTLEALLFGGVGYLLWQAGAP… |
| A0A2E3YEQ7 | 135-240 | None |
| A0A3D5FIE3 | 69-188 | None |
| A0A2W4NZN7 | 66-177 | None |
| A0A5Q2VZF6 | 164-273 | None |
| A0A4U3L085 | 6-109 | None |
| A0A0H5NYH9 | 3-117 | None |
| A0A126Z6R9 | 4-108 | None |
| A0A7Y9LSN3 | 4-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.