DPCstruct | MC52645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 104 ± 20 aa |
| Standard deviation of domain lengths | 19.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 64.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7PHF4 | 180-252 | VPSYLSKLVFPQEFITALRTIAMKEDELDKVSSLLGELAGSEEEREPSASEVQAAVWEVCGDYGALELLVDLL |
| A0A7J7H7D2 | 1-108 | MVFFPPSSPQKESNDKCTVDRFCNYSWCGQRKMPSYVKKLVFPEDFLTTLRTIAKQEDEIYQVSSLLQELVSFDGEKQPSDGEVRAV… |
| A0A453QI40 | 118-230 | None |
| W9QS29 | 181-254 | None |
| A0A166FG65 | 527-649 | None |
| A0A2H5NPS5 | 284-407 | None |
| A0A484MVP6 | 86-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.