DPCstruct | MC52643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7GYU8 | 43-107 | GERDSTPLHRAAKLLINAQMDNGDVPQQEMSGAFIRNCMLHYAQYRNIFPMWALGEYRKCVWPSS |
| G2Q9M7 | 2-77 | TAWALIGLMKANYPDKKPIMKGIKLLMERQQPNGEWLQEAIEGVFNKSCMISYPNYKFTFPMKALGMFAHKYPDET |
| A0A7J0GCY0 | 527-602 | None |
| A0A6P4Q4W1 | 73-137 | None |
| A0A164Y9Z4 | 11-85 | None |
| A0A395GWH9 | 1-87 | None |
| A0A067KXK6 | 237-309 | None |
| A0A5J6SDC9 | 434-524 | None |
| A0A7S2Z1M7 | 79-146 | None |
| A0A804LR14 | 140-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.