DPCstruct | MC52640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 123 ± 25 aa |
| Standard deviation of domain lengths | 25.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.23 |
| Pfam Score | 96.74 |
| Assigned Pfam label(s) | PF04990- PF04997- PF04998- CL0523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819AX53 | 1-82 | MAPYRTLSRVQFGILSPDEIRRMSMTNPPIEYTELFEEGKPKMQGLMDPRQGPADHNSRCFTCSGSYLECPGHFGHIECRYF |
| A0A7J7GLV9 | 9-141 | LQFTKKPYVEDIGPRKIKSIQFSMFSESDIYKAAEVEVYRGVYYDQFKKPHENGLLDPRMADLGQGPPNKFSFCATCHGSFTDCPGH… |
| A0A0P7I0W8 | 1-127 | None |
| A0A834SQQ6 | 10-149 | None |
| A0A5J4VK66 | 1-125 | None |
| A0A0M3IXH9 | 2-98 | None |
| A0A2K1J7D9 | 2-97 | None |
| A0A835R4S9 | 1-124 | None |
| A0A0A9MYH9 | 1-103 | None |
| P14248 | 12-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.