DPCstruct | MC52639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 25.08 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7GJD2 | 4-123 | EKYICLYGGEDLDWIRSFTNTAKVVAKATQIPLELLYVGKSNPRRKVVKIKNVIMVEKLSHTMPDLILIWHFWDRCESMWHSKKQHG… |
| A0A0V0HD71 | 1-140 | MASGKFICLYGGEDMDWIRNFTKSARSVAQKAGIDLQMLYVGKSNNKERVRRINSMITAENLSYCLMDLTSVWYFWTRIESMFYSKM… |
| A0A6N2NJX7 | 953-1109 | None |
| A0A2P5ECP3 | 442-583 | None |
| A0A5N5LR47 | 319-458 | None |
| A0A6A3ANR9 | 534-654 | None |
| A0A6A3B3W6 | 115-259 | None |
| A0A6A6KU17 | 452-570 | None |
| A0A6A6KU35 | 310-421 | None |
| A0A6A6KWS1 | 26-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.