DPCstruct | MC52637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 130 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 50.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6PTC4 | 2-83 | TVWNHIQPDYAANIWNEALNKRLGTQGLDLPEILVEIERRGLSFDELLAIPEQDDWIYSDGKSTSCVVFILEMFKAAGLFDP |
| A0A7J7GG78 | 1-133 | MVGKPYGYHNPIFSWIDTIDGNYPPPLDAHVVASVMTVWNNVQPDYAANMWNEALNKRLGTKGLDLPEILVEAERRGSSFDELLTIP… |
| A0A2I0KJJ0 | 2-141 | None |
| B4G0B4 | 166-292 | None |
| A0A813A273 | 675-845 | None |
| A0A5D3BGZ0 | 309-418 | None |
| A0A6A3CSC1 | 68-193 | None |
| A0A0A9P9M4 | 3-96 | None |
| A0A812Q4C3 | 220-348 | None |
| A0A6N2NHK4 | 341-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.