DPCstruct | MC52635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 63.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08969 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4B965 | 1-84 | MSVVSQVTDPAARLKLLCDYGSQVEVDYSLPTKLYYRSGRELIRMATVYLDEANLESAFILYSKYITLFVERLPSHPEYKSVHP |
| A0A2P4SPQ5 | 1-68 | MPNHADVSLPPEERVRSLIQMGSAVEVNEDVPPRRYYRSGVEILRMATIYSEEGNIEHAFILYNKYIT |
| A0A498MVH5 | 284-371 | None |
| A0A0L7KRZ6 | 16-90 | None |
| A0A836AIV6 | 23-115 | None |
| A0A804HJD9 | 1-95 | None |
| A0A673BIY8 | 7-83 | None |
| A0A4W6G3L5 | 1-86 | None |
| A0A1V4KR39 | 332-415 | None |
| M7AUZ2 | 178-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.