DPCstruct | MC52632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.83 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0330- PF03455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4B1V6 | 16-124 | SCILKGYRNFLNPISSSQLNLKATNAASLFDMQGTYYKIIHTMLFFVGFVKSRDKAYAKFFNQVLKTQMFIRFVEERSFVSENDASL… |
| A0A3P6Q7F9 | 8-106 | KELEMAIHEAFLRFMANLMRGYQSFLKPIKSAPSCVNATDTGNLFDLDGFLKSRDKSGVEFFKRFCATQSFIRFIEERSFVSDKNTY… |
| A0A0L7L9R2 | 316-419 | None |
| A0A835TPH5 | 101-215 | None |
| A0A4W5KTQ9 | 40-136 | None |
| A0A183EMQ5 | 55-153 | None |
| A0A834FQS1 | 376-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.