DPCstruct | MC52631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 477 ± 32 aa |
| Standard deviation of domain lengths | 31.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0673- PF19432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4AWQ4 | 1-417 | MAIVKGAGMVMKAIIEEGDAEIAAKMQDLALAEGALPKHLHTAMFTQSNDSRMLTNRQLSRHLVGLWVTGHPTAMGLLRRILPSGLL… |
| A0A183DU83 | 1-470 | MVAARGPSFYRLFQYPSMTIVKGAGMVMRAIIEESTVDISKRMQMLSLTEGAFLRHLHMALLSVGRDLRILANRQLSGYLLSLWIAD… |
| A1Z7S0 | 581-1062 | None |
| A0A6J0YW09 | 576-1061 | None |
| A0A482VMC3 | 499-944 | None |
| A0A182EI93 | 293-792 | None |
| A0A368FDJ1 | 46-534 | None |
| A0A0K0D2Y9 | 199-698 | None |
| A0A077ZJH8 | 5-422 | None |
| A0A3P7SF78 | 34-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.