DPCstruct | MC5263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 19.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2S1R1 | 19-205 | IVTWNWQLNILKINMKTIFQILFTIFISDCSAQISQSKIMTTQFTDKEIIEQSYQIKKADTIFVKNNKLDISKLVKEDGDATVVKVS… |
| A0A242NYD0 | 9-117 | FFDINKFEKNRNGSEWNFTISNGTQVRQIKESDGYTVEMRPVNSAYVYSSGYNKKGEITITGVRFYGNGVKKWIYFNDKQEIIKEID… |
| A0A2X2WI08 | 5-171 | None |
| A0A7H8PR64 | 1-109 | None |
| A0A1M5WXE1 | 12-137 | None |
| A0A246GCP2 | 8-156 | None |
| A0A0Q6AEN5 | 16-152 | None |
| A0A2T4HHB3 | 1-97 | None |
| U2ANE6 | 2-129 | None |
| A0A2S8ABG2 | 25-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.