DPCstruct | MC52627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 66.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V3ZHM3 | 1-125 | MAKKFGLGSLSLETKKPNTTAWINKTKPYFVDQIGDTFQGDLDMNNFKVTNLKSSENDNDAVHKKYLWDQINSIEMIRLQNKKLDIQ… |
| V4AMK4 | 1-137 | MANKFGLGSLSLETKKPNTTAWINKAKPYFLDQIGDTLQGDLDMNNFSITNLKSPENNNDAIHKKYLIEQLNLIEVNKNHLNERIGD… |
| V3ZA91 | 1-120 | None |
| V4A282 | 1-150 | None |
| V3ZX22 | 1-151 | None |
| V4A653 | 1-116 | None |
| V3ZUZ3 | 1-140 | None |
| V3ZLH8 | 222-363 | None |
| V4BIW1 | 1-110 | None |
| V3ZWS2 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.