DPCstruct | MC52625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 19.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3WCT9 | 1-159 | MSLNGGGSRGFYFNTVLSLARSLAAHQQAPIDKVQKLKCMCPVDFRGVYQLDERRRNAVIALGIFLVESNLQHKDVIVPYLLGLLKG… |
| A0A0K8UNG3 | 7-145 | YQRTVQSLARVLARIEPTPWDKVQSLFRYCPQENAAGVFCLDAKAQDAVIALGIYFLESGCQHEQHIVPYLLRLAKCLPKAVWVDDA… |
| A0A3P7PAX1 | 6-132 | None |
| A0A7R9HL50 | 23-141 | None |
| A0A6I9Z300 | 1-120 | None |
| T1GS00 | 3-120 | None |
| A0A821JCD2 | 1-173 | None |
| A9JRB4 | 1-117 | None |
| A0A2H1CQ09 | 4-147 | None |
| A0A7R8ZNQ6 | 3-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.