DPCstruct | MC52623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3W505 | 4-108 | MTKTATPSRKLSKAARDFAGESGSDVKKISPGQRRERHNRKERERRRRIRSYCDELNMLVPFCQSTSGMLATLQWTTAFLKYINDTY… |
| A0A493T6K6 | 1-118 | MCDSQSTVPAQGSWQSAQSNPSVQVQSGTQEGVAQRRERHNRMERDRRRRIRICCDELNLLVPFCTADTDKATTLQWTTAFLKYIQE… |
| A0A667ZI55 | 222-346 | None |
| A0A6I9KHH8 | 278-396 | None |
| A0A6F9CN56 | 98-201 | None |
| A0A485NIV7 | 106-224 | None |
| A0A1A8AR64 | 272-396 | None |
| A0A6B0R760 | 69-175 | None |
| A0A674N158 | 1-94 | None |
| A0A3B3RZF6 | 56-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.