DPCstruct | MC52611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 243 ± 33 aa |
| Standard deviation of domain lengths | 32.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.50 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF08797- PF14472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2ZB63 | 263-512 | VNAKPDGVMIETIECGVEISGDEDHQRILKRYGYDAWIWVYVMEDRIRKGKYAGYPTYWVFLDGEEIGYISKYQMERHCGQVPPEGA… |
| A0A6P1FAI1 | 48-308 | RTVLRLPNADGTPTVDAIDEAERIEEIADALGRPVRPGEVVEESLDVELIPEPDHPTGAPAVSVRARGRVIGYLPDAASYRPAIDRI… |
| A0A1X1XYZ2 | 4-233 | None |
| A0A147FB61 | 134-417 | None |
| A0A0F5NDN9 | 39-226 | None |
| D3QAG3 | 277-522 | None |
| A0A4P8PNW9 | 22-277 | None |
| G8S5A2 | 13-277 | None |
| A0A810LVT7 | 10-279 | None |
| A0A397JC68 | 499-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.