DPCstruct | MC5261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 158 ± 23 aa |
| Standard deviation of domain lengths | 23.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850B6T3 | 222-372 | QEKIPQGDWTYFIDGEKPKWSKIIISGISHGASSSAVIGKHRLVHGVVSLSGPLDSGQAWLKKPSITPIDRFFAFTHTDDGQHAGHL… |
| A0A1G7FFJ5 | 2-123 | ENGQPKWEEIALAGQSQGGGMSAFIAKTHRVARVIDFSGGWDYSAKNKIADWYFKDSKTPLDRWYGTYHVKELAAPTIIKTYKAMNI… |
| A0A7S2C485 | 2-156 | None |
| A0A7S1E7A9 | 68-245 | None |
| A0A6M1E1C7 | 93-233 | None |
| R1DJN0 | 22-144 | None |
| A0A7W1W0E3 | 1-126 | None |
| A0A517SWB9 | 405-555 | None |
| A0A2V7L1H4 | 446-660 | None |
| A0A3S0CDM5 | 169-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.