DPCstruct | MC52608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 100 ± 18 aa |
| Standard deviation of domain lengths | 17.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0VXR7 | 1-116 | YAKGYPPYSPYIGSSPTFCHLLHEKVPFCCLRLDKSCQHNYYEDAKAYGFKNKLIIVAAETAGNVLYNFIVPLRAYYRPKKELNPVI… |
| A0A4Z2HZC2 | 1-91 | MPFCCLRMDKACPHTVFEDARSYGFKNKLIIVSAESAGNGLYNFIVPLRAYYRPRKELNPIVLLLESIPEADFLEAICWFPMVFYTV… |
| A0A3Q0JI04 | 3-85 | None |
| A0A484CF59 | 2-83 | None |
| A0A3P6U861 | 1-103 | None |
| A0A0M3J429 | 2-86 | None |
| A0A182S9B9 | 1-99 | None |
| S4RL33 | 187-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.