DPCstruct | MC52602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 236 ± 38 aa |
| Standard deviation of domain lengths | 38.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05612 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7BTP9 | 214-456 | GSNNVGNILWGLPLQLGWQYHTGRLADPSNVTTCSHGAGQHLCISVRSWWASVNYYLSIIPFLGATEAGFFGQLQHEIKILPPEELR… |
| A0A668VHY8 | 75-306 | GSMGTNATDSPLWGLPLQLGWMLTSGRLADPTGATTCGLEAEPLCISTQSWWACVNYFASVLPFLSAAQQGFMGAGAQVQMQVPAGV… |
| A0A6B0RIH8 | 735-956 | None |
| A0A091DNA4 | 106-278 | None |
| A0A7S1YV98 | 3-307 | None |
| A0A672UUH3 | 2-223 | None |
| A0A6A1QBQ4 | 374-584 | None |
| A0A2Y9M618 | 13-215 | None |
| B7G0W6 | 161-483 | None |
| A0A3L7I3R7 | 29-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.