DPCstruct | MC52600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Standard deviation of domain lengths | 18.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256B9U2 | 11-151 | PSGSESRQSHVEFIRVNLELLLAVAWHGYESEGRGAIVIDVSKSKESQIGISPYQKWLNSESYGSYLSQATADRIAAESGQPNPFQK… |
| A0A137QL26 | 796-943 | QPVEQALFGKARWAKDRIHWMFPPDKDERVSQILAWIESVSYQLGTFGLHKFLQSRERGALIINAGYRLPELPGQPVFDWLTFDRLQ… |
| A0A2T2THG2 | 45-173 | None |
| A0A3M1HC16 | 4-116 | None |
| K5V8B9 | 96-253 | None |
| A0A6A4GJV0 | 36-190 | None |
| A0A814UHD1 | 4-131 | None |
| A0A166C3L3 | 12-158 | None |
| A0A0C9UIP5 | 17-172 | None |
| A0A4S8MR84 | 43-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.