DPCstruct | MC526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 148 ± 28 aa |
| Standard deviation of domain lengths | 28.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4QXE8 | 1-118 | MMRTFVSDINTSIRNSWIQIPSIPGSADVKFIVKNNSDEIGKPLGTSVVFTTSLWVNASPYQLFNFLRHGSSRKKWDLLSHHLSVRE… |
| A0A124SBM8 | 1-104 | MLKLAQRVMDNFCAGVSASTVYKWNKLCVNNVDEDVGVMTRQSVDDPGEPPGIVSSAATSVWLPMSPQRLFNFLREERLRSEWDILS… |
| A0A2K2DFH1 | 204-389 | None |
| A0A444BV96 | 312-499 | None |
| A0A446UGW0 | 140-311 | None |
| A0A1S4BW65 | 2-115 | None |
| A0A287RZA7 | 53-221 | None |
| A0A5C7J2M7 | 142-299 | None |
| A0A1U8KI44 | 1-114 | None |
| A0A287RZB1 | 381-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.