DPCstruct | MC52595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26312 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Standard deviation of domain lengths | 21.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 10.85 |
| Pfam Score | 54.45 |
| Assigned Pfam label(s) | PF11797- CL0003- PF01324- PF20254- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662RZM0 | 3-109 | RPAVAFMNVIISGEVRLGQSFEIKGEVRNRGEVKVTNVEIMVYLEGKVLKKVSLGEISPSEREEFTIEVTIPSDIALGPHNLILLLT… |
| A0A6F8Z1C3 | 165-267 | ANHNPRASVREGLDLKRKPGKQVTLRGRGSDPDGDRLTYRWWQYTDADTYPGTVTLNDANTPTVSFTVPADAVPGQTIHLILEVTDD… |
| A0A6M1LEH1 | 581-718 | None |
| A0A1Y4HFA8 | 178-297 | None |
| A0A6P4EMU5 | 204-320 | None |
| A0A099NZS1 | 673-780 | None |
| A0A6P4EDR3 | 85-212 | None |
| A0A1G1A4F1 | 783-925 | None |
| A0A7V3AFN6 | 413-524 | None |
| A0A7V3AFB3 | 591-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.