DPCstruct | MC5259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 282 ± 39 aa |
| Standard deviation of domain lengths | 39.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15994 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9KDL3 | 57-287 | DFKRQTKQITKINRKQITGPTWYQELSDQQISVLDNLFHNMKEDFDLATSKSTRRALKALGVRTFIPHTVAVDALVKTELYVVDFLQ… |
| A0A6J2SWL5 | 3-237 | EFNDLEQSLRWYRNLSDLQIGACNDLLHALRDDICEETAYRVHDCLDMLGLHPLPSSKQLKTIIEISQGNDLAFLWFLWEAYYKDQN… |
| A0A6P8YLV1 | 114-327 | None |
| A0A6J2U9C2 | 9-375 | None |
| T1GX88 | 9-283 | None |
| A0A7R9I4Y6 | 1-298 | None |
| B0W788 | 1-289 | None |
| B4NJS2 | 1-302 | None |
| A0A182UAB1 | 9-300 | None |
| T1I9B9 | 2-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.