DPCstruct | MC52589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 177 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2RWX5 | 345-517 | WRIKSAINARRIMINDISGFHDEMEGKPYLIWWPLKPHRKCLEVLAKKCPSMQEQIAIACIVCDYKDIYESINPEPHWRIRLAATKN… |
| X0JIF4 | 1-156 | MPYIIWWPLQPQSDMLSLLAIKVPEMKRQCAAAAIVCDYENVYKNLDPEPSWHLWKVASEFAANPFYREDQEWRGRENDVDVKDDSF… |
| A0A1E3BMB5 | 172-335 | None |
| A0A166U642 | 546-744 | None |
| A0A366NSV4 | 103-282 | None |
| A0A0U5FU50 | 303-493 | None |
| A0A2L2TJV8 | 328-496 | None |
| A0A178EPR3 | 704-880 | None |
| A0A4E9DY94 | 327-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.