DPCstruct | MC5258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 16.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2ST78 | 6-138 | RQRVESAVTELIDDMDKTHLRKMQTDMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQNYVQHELGEFQGRLQRCVMQCNDDVKV… |
| A0A6J0DT78 | 2-104 | FRCSANCCEDNQASMQQVHQCIERCHAPLAQAQALVTSELERFQDRLARCTMHCNDKAKDSMDAGNKELQVKRQLDSCVAKCVDDHM… |
| F0WG07 | 477-615 | None |
| W6NV13 | 10-138 | None |
| A0A175YPJ8 | 154-288 | None |
| A0A075A7C5 | 29-172 | None |
| G1MC07 | 61-195 | None |
| A0A6J1P1B3 | 130-256 | None |
| A7AUI4 | 8-149 | None |
| A0A2A6CHH0 | 23-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.