DPCstruct | MC52577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6ZSJ5 | 1-128 | MLRLLLIAIPILVVVTIYAVVDCAMIAKGRIRGLSRPAWIVLILILPLIGLVLWFVIGRGPAGPVVRPASPDDDPLFLSDLDRADQD… |
| A0A1H6W920 | 1-93 | MLKVLPLLAYIGLVIYALSDLWQRPDREPYGVSRGLWTAMIIFLPFIGALAWIVVSMLRPDNGTDRRSGPVAPDDDPEYLAWLREQT… |
| G7H106 | 3-119 | None |
| A0A7W7GRS9 | 1-101 | None |
| A0A0Q9L7N8 | 1-124 | None |
| A0A418UQW9 | 2-152 | None |
| A0A4Y3UMG1 | 1-119 | None |
| A0A7X6UCP2 | 1-128 | None |
| A0A1V5JGB3 | 1-139 | None |
| A0A2S0WTG1 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.