DPCstruct | MC5256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 17.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R8AQ96 | 2-116 | HGKHASVVNPNNLGPVTCTNCHGNPSARHREGVNDVMVFTDENMPLEQRNGVCLSCHEPDNLRKTFWAHDVHVTKTACTNCHQLHTA… |
| A0A2T3IZS1 | 74-200 | LKGAHSTAINPHTNRDVTCVDCHSNVGSDHRNGASEVTKFAPAQSVAGSEKPAADVAWITQQNETCVNCHEPENLREVNWTHDVHAL… |
| A0A1G8K0W0 | 43-147 | None |
| A0A0B8PB80 | 5-121 | None |
| A0A090T3C5 | 26-152 | None |
| A0A376NYE6 | 554-666 | None |
| A0A182SBA1 | 61-173 | None |
| A0A380TLD7 | 78-203 | None |
| A0A7Y4C951 | 55-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.