DPCstruct | MC5255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2CFJ2 | 6-94 | LMAPKDHQGKPVFYTILGHVSRSGMSQCISIHYFDTQAGELRQLNYPSAVILGYSLDAKHEAIRINGAGMDMGFVLIYALAEKLLGD… |
| A0A1V3JSR4 | 5-103 | VVDYLIRHKNERYIISAAVKKVSRNRLVRHIAFYINIDERLINISKDIANVIDEKIQNNGSSNVIVIKGCGSDMVFEILYRFFNRLS… |
| A0A6M3JX66 | 6-91 | None |
| A0A2N3PK87 | 3-92 | None |
| A0A3A4WGC8 | 6-111 | None |
| A0A1B8Q4F6 | 15-103 | None |
| A0A0F9K9Z3 | 5-95 | None |
| A0A3E4YKQ0 | 1-95 | None |
| A0A825VAS8 | 1-85 | None |
| A0A3C0G217 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.