DPCstruct | MC52541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 174 ± 22 aa |
| Standard deviation of domain lengths | 22.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4YLT2 | 1-176 | MATNPVPPEAQLIRERRKDRLPPLSVRDAAAAATAAGVSMSEAGWRSIESGRYDGPPDKIAIMSAVVGIAPDELADLGRRAKRANVT… |
| A0A806VXJ6 | 1-149 | MTARTALDPDRVPPVAGVLRRAWHESGLSVPRIAAETDISAASIRNFFQGWRINSKNHKPIPSTPPDKYLVPLADVLHIDPSELRAV… |
| A0A329LXH1 | 81-272 | None |
| A0A7T7RFR2 | 1-148 | None |
| A0A7U3UTF8 | 3-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.