DPCstruct | MC5254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 199 ± 30 aa |
| Standard deviation of domain lengths | 29.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A364K509 | 6-244 | TELIQEFRWKVNSNHYYVLNKYADFDGKNLWSVICSAMDWIEVAVDGIPYIQLKHQNTNFVSLSLMQLICAMDLIVKAIIQLYRVFK… |
| A0A1V3JPX0 | 4-216 | YELQDRIRTFCRSKEKYDDEFKTICAALDLISDCNDAIHSYIELPSNSGRGINYVYIYGIIHILNIQTDAVKVIYQHFLGKQLKLND… |
| U4KNX0 | 3-217 | None |
| A0A4R0FJC2 | 13-191 | None |
| A0A3A5KNF1 | 1-141 | None |
| A0A840E643 | 6-202 | None |
| A0A849MMM8 | 1-165 | None |
| A0A800NFQ4 | 1-217 | None |
| A0A259CND9 | 3-143 | None |
| A0A1V5NB75 | 34-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.