DPCstruct | MC5253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 153 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | PF04039- PF20501- PF13244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9V8U2 | 280-438 | MVLLLRRLPLRFQREKKRPRIVAAVVAVGAGVATTLGVWAFTGRREMSEAAAYYLREGEELTGGANIVNTILVDFRALDTLGELTVL… |
| W7Q3D2 | 33-191 | MILMILALFFLPQRPPLLVSGRRILRDLILAASLGVVVAMLNYALLTRETLTIADYFLRESLPGGGGTNVVNVILVDFRGFDTLGEI… |
| W9T924 | 11-169 | None |
| A0A1Y4LSS9 | 88-242 | None |
| A0A0B8NKT8 | 2-151 | None |
| A0A1H9F465 | 58-193 | None |
| A0A833NSF8 | 1-150 | None |
| A0A7Y2U686 | 425-560 | None |
| A0A7V9JNZ2 | 1-145 | None |
| A0A4Y3V6U1 | 906-1084 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.