DPCstruct | MC52529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 386 ± 67 aa |
| Standard deviation of domain lengths | 67.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 15.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1DTC3 | 297-757 | DVDTSRNGNWIDFSCNHTVVTNRLKIDPSEQWKLLDADGAWADIVRIYRDTDKKEKMSFSASFETTTQVGSSLDCQSIGEKGNSCNA… |
| A0A175W6R6 | 888-1318 | YTPSERWRAVKADDAWRDVVRIWKDTDSHRLQANFMTSVTDTLDMGGGTHCERIDGCSCDTRRDCPNSANGPFSGAAAQFIYNSLVT… |
| A0A3M7M4F5 | 30-399 | None |
| A0A2S4W119 | 31-413 | None |
| E3KRI8 | 14-350 | None |
| A0A093XK47 | 288-723 | None |
| A0A6G1I545 | 313-741 | None |
| A0A2V5IS39 | 512-906 | None |
| A0A366SAT0 | 22-418 | None |
| A0A6A6Z2S8 | 73-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.