DPCstruct | MC52527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 154 ± 13 aa |
| Standard deviation of domain lengths | 12.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084G3N0 | 1-150 | MFNSGLLAFSGQLWLATLALTQVTSPASSCFPVTSTFRHIDLGINSDLVASSSFKSSMDAKYNTPATPTPVAIYTASTVIGTRTLRA… |
| A0A507AUL6 | 1-182 | MNHFLRGLVLLAGPVAVVMGLPQGPITAAPVETSCADVTSTRWGIDTTVTDYYGFAQSLISKYLTSGHSHTGTRIPIHTTTRYDSSR… |
| Q2H639 | 8-157 | None |
| A0A3N2Q869 | 3-143 | None |
| A0A3N4IGG6 | 1-139 | None |
| A0A094H728 | 235-389 | None |
| A0A7C8U1D2 | 9-159 | None |
| A0A2N3N0L8 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.