DPCstruct | MC52518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3DGW9 | 3-59 | IRKLHIEEPDIDVALVRRLLSSQMPQWANLPLRLVESIGTDNVMIRLGDLLVIRMPR |
| C2YTF6 | 4-61 | IHTELVKKLIGEQFPKWAHLEVKPVKFSGHDNRTFHLGDEMSVRLPSDEAYAPQVEKE |
| A0A1H3KX73 | 1-60 | None |
| V6JP81 | 7-73 | None |
| A0A0Q8LHN4 | 2-61 | None |
| A0A0D8FX14 | 1-68 | None |
| A0A1C4QJJ7 | 422-506 | None |
| A0A7Z6TPQ1 | 13-80 | None |
| A0A6F8T6K0 | 1-54 | None |
| A0A1Q9TRJ1 | 5-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.