DPCstruct | MC52508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00499 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6BIM3 | 1-121 | MQSIAKQLFSTYVWPFEVVSALLITAALGAMVLAHHQRTILRPTQREQAINRFRSGSLASAAGLPGPGVFARHNAVDVPALLPDGSA… |
| A0A3P1V5J1 | 150-251 | IAEVLFGQHVVTMQLTALLLVTAAVGALALTHRQRIRAKRTQGEVAEDKMRAYAATGAHPGQKPMPGVYASTNSAAAPALDAAGRVV… |
| A0A6J6E4W9 | 59-178 | None |
| A0A652KTB6 | 148-261 | None |
| A0A6J6PDP9 | 1-97 | None |
| W4U862 | 96-195 | None |
| A0A850CEU8 | 1-138 | None |
| A0A7G1IHR8 | 2-83 | None |
| A0A1H6WB30 | 127-244 | None |
| A0A1M4TP50 | 152-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.