DPCstruct | MC52504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 21.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9EBM4 | 1-104 | MMESIKNIGKNEFVFQRTNHKAYYFSPVNICFVYNGNHSIGAGIGFKKGHIEAAEYDVSKIFDHVYADGLWWYNRHSNQRLGNLLDF… |
| A0A486S3X0 | 31-152 | PLSLASDMVLPWPWSLQRFINNVSRIGSYKGKPWKQDNSNHYVELWLPWRIGFVGGGNHSITAGILAGEGTLIPEHVYDMSWLFELV… |
| A0A3T1A4H9 | 2-96 | None |
| A0A7V8IVN0 | 19-143 | None |
| R5GMU2 | 61-213 | None |
| A0A1R1VUZ6 | 65-175 | None |
| A0A7Y7D572 | 134-259 | None |
| A0A139QA95 | 7-137 | None |
| A0A1W6QWX9 | 2-76 | None |
| A0A7K3JC03 | 7-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.