DPCstruct | MC525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 106 ± 2 aa |
| Standard deviation of domain lengths | 2.41 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A124SAJ5 | 63-164 | RDLKYNRRSQSVQLRKLDHSVAQAMRVASSPQEWRERGKKLYSENNFVMATMCFERAGDRMWEKLAKALGLRTFAEQMRGMNFEAAS… |
| A0A453CVH2 | 80-185 | MFDYWKKLCLVEVRLLDSSLIQAMQTGSSSDDWRLRGTKLFNEGQFEMATMCFEKAGDAHREKLARAAGLVATANRVISTNLELGKA… |
| A0A843W018 | 792-896 | None |
| A0A7J6W4L6 | 56-162 | None |
| A0A7J6W032 | 78-182 | None |
| A0A4Y7INR1 | 570-673 | None |
| A0A6S7FTA4 | 88-197 | None |
| A0A1R3HQH9 | 277-380 | None |
| A0A0P0WE98 | 1411-1519 | None |
| A0A287RVF2 | 483-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.