DPCstruct | MC52494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 28.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B4PK42 | 4-162 | SEFQRPTLAENISMLRNDLFARLDVSDTLRRMDEDVRAKVYAAALHTVYGYIDYLAMNMLPDLCDESWLARHAAMKRCPRKGATVAS… |
| A0A2E6HU82 | 251-357 | GDETSLVVLEFTNSSSKPYSLAKGFQVRTEDYLSFAIIEDVIVGPGEVVLVSALCGIAGEIGNVTADTLTIGILPTEIAVTNPEPAF… |
| A0A5C7QJI9 | 142-358 | None |
| A0A7C5J315 | 1-155 | None |
| A0A509B3V4 | 1-140 | None |
| A0A843FA26 | 10-188 | None |
| A0A3S4JT09 | 5-157 | None |
| A0A5C7PP49 | 6-212 | None |
| A0A350PFI2 | 3-150 | None |
| A0A0H3A7N3 | 22-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.