DPCstruct | MC52492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0606 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3HTE9 | 13-107 | RGFYESHSLIVNDNLACKKLFAADEIVARGGNQIRMIGGEYGALWRNDGAKTYLLLTNQGDVYGGWNTLRPFAIDNATGELVIGTKL… |
| A0A7W3G1N7 | 72-154 | YVLVNAIINGEVVSKSANGFRIAYGNYGFFVRNDGSNTYFMLTNAGDSMGSYNGLRPFCINNATGAVTMGNGLTVSGGLNVSS |
| A0A827FX06 | 738-822 | None |
| A0A328TQ00 | 448-523 | None |
| A0A2Y4XGY3 | 85-162 | None |
| A0A7U9ITN3 | 567-647 | None |
| A0A8B3TTA0 | 246-331 | None |
| A0A6L9CAE5 | 224-337 | None |
| A0A376TKF3 | 112-193 | None |
| A0A7G9G5K3 | 729-821 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.