DPCstruct | MC5249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7EFQ2 | 1-52 | GAGAVNQAVKAIAIARGFVAPNGIDLIAIPAFSEIEIDGEMRTAIKFIVEPR |
| A0A7X5DF48 | 1-68 | ATVEIQAVGAGAVNQAVKAVAISRGFLSPVGIEICCIPSFADIVIDGEYRTAIRFAVEPRAGLAAAPV |
| A0A7V5YGG2 | 3-66 | None |
| D0WEK5 | 6-73 | None |
| A0A7X8X5A5 | 1-60 | None |
| A0A7Z9WPA5 | 23-106 | None |
| A0A6J4UDH9 | 134-193 | None |
| A0A838SR37 | 1-69 | None |
| A0A1M6MAP1 | 58-116 | None |
| A0A3S0X4N0 | 28-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.