DPCstruct | MC52481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2200 |
|---|---|
| Mean domain length (aa) | 167 ± 31 aa |
| Standard deviation of domain lengths | 30.69 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.31 |
| Pfam Score | 89.07 |
| Assigned Pfam label(s) | CL0023- CL0270- PF19319- CL0479- PF08350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4RP59 | 23-164 | CPSAIIVGPSNASLIATYISKAHKAVYIEVYALTWKELADTLAALANRGVQVYLVLSANVYGGIPTTEKKLVQYLQSAGVNIAFNND… |
| A0A2K1Q562 | 17-172 | EPRVINNAEAHDACLTDILQLAQQRVVIVSPWVSLFRLRESGILSTMQQAVERDISVELYTDYRFNSFTNHRFDEEKNAQFKACCTE… |
| A0A426TQR1 | 16-170 | None |
| A0A158R4G8 | 41-202 | None |
| A0A2H6BNC0 | 34-202 | None |
| A0A841JRE1 | 78-260 | None |
| A0A2Z4FMJ3 | 277-447 | None |
| A0A819S457 | 228-400 | None |
| A0A212DSE5 | 1-136 | None |
| G7EFX4 | 202-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.