DPCstruct | MC5248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3LU93 | 19-93 | QVAKEIGSMATVLKGHVEAIILTGGIAHDELFVNWIKERVDFISSVIVYPGEDELIALAEGGLRVLRGEEKTKQY |
| A0A7X5DE63 | 4-82 | KAIGSMAVVLEGRVDGILLGGGMAHSEDLVQRLRDTCAWIAPVTAYPGEFEMEAMAAGAPRRVLSGAEEPKRYTGDPVW |
| A0A354HVF3 | 156-237 | None |
| A0A090SR98 | 83-163 | None |
| A0A0U1KSG1 | 2-57 | None |
| T0D091 | 50-133 | None |
| A0A661KYA5 | 3-66 | None |
| R6GVC9 | 5-67 | None |
| A0A3C0J1G5 | 127-207 | None |
| A0A645EW30 | 107-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.