DPCstruct | MC52479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 18.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2GN46 | 8-135 | LDLEEIAWAMQDDRSMGNEYYLDLDTGEVVVPGLDEDITLEEIVEGNYAYVDPLESYESYRHMEDFTVGLPEGGARVKLEQALIRSK… |
| A0A537N0K6 | 5-153 | VQLKDVVGEMEIGGNEWTAYVNRKTGELTSFPNDLLRYEGEAGTAVGEWDEEMAADYKRVLDSQDFIGLPGEYEIQEYAIMERFCLS… |
| A0A2S9YNK7 | 10-158 | None |
| A0A651FYA0 | 8-150 | None |
| A0A6P1NVF3 | 11-127 | None |
| A0A4V2DZA9 | 19-162 | None |
| A0A7Y4GQL4 | 2-81 | None |
| A0A6I7QVW3 | 2-111 | None |
| R9M035 | 5-142 | None |
| A0A2E0RR66 | 4-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.