DPCstruct | MC52475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 192 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18928 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3Q8S6 | 1-221 | MKTFEQIFEEVIVKVVEMHPDLTEQDIAGASANLLSQFIPAVARDMCKDLKRRMPQLLARARKSDAGFEKRNLKRWRKPFDLLELLW… |
| R7LS90 | 1-202 | MKTYHEIFLKLIEENKITITKKLEKDPNFIQSIMNFAINNSSKILFKDLDKDKKNMLTENRKIASDYNKTLYNQWKKPIDNLETIIE… |
| A0A1M6M8Q2 | 5-200 | None |
| A0A0F9SIQ6 | 147-333 | None |
| A0A554MTZ9 | 1-188 | None |
| A0A6L9KWF7 | 70-260 | None |
| E0PDJ9 | 5-188 | None |
| A0A3N4DAE1 | 2-158 | None |
| A0A1V4UZT4 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.