DPCstruct | MC5247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Standard deviation of domain lengths | 18.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5DBZ4 | 137-270 | IPSVREGKFNRFFNSLTPDELDDLWKDERIKKTISSRLRQPGKLHEWHMVAATPKFKRWGLTAERIKETRSLIKDVEFVNPAGKHGE… |
| A0A2S1AGK6 | 6-135 | VRNNEFNKWFDNLSAKEFEEMWNNPQLRSKIEDRIRRPGGYHEWHLVARTPKFKQWGISMDDIKEMRSLTKDVEFVNPPGRHGRRGS… |
| A0A7X9MW62 | 347-499 | None |
| A0A806THX9 | 5-125 | None |
| A0A7I8FSM3 | 308-464 | None |
| B7JLP3 | 20-168 | None |
| A0A0T0M9P2 | 67-204 | None |
| A0A1V5M6Y6 | 343-495 | None |
| A0A839EXP3 | 370-514 | None |
| A0A1X7H3C2 | 27-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.