DPCstruct | MC52462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 14.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8EF44 | 1-113 | MAMNMKSAMNKEICLYCRREAPNLRKGWQLVCSGFAQLCDECAAIYESGRFCEVFHGESKGWKECEKCDKMLHCGCIMSQHKLVMLD… |
| A0A6A5BWU6 | 4-106 | YPLVCGNVKCKTNQTPLWRKGWTTKEGKPVMLCNACGLHYKKGHFCVYCNQIYKESDADDKEQPWIGCDSCHRWVHQNCEKSNGYEI… |
| A0A4S4D882 | 209-304 | None |
| A0A6A6L670 | 3-117 | None |
| A0A2U1QFE1 | 6-108 | None |
| A0A0A0LT15 | 1-97 | None |
| A0A1J6I1X8 | 4-108 | None |
| A0A3S4PIF7 | 39-132 | None |
| A0A835R280 | 21-123 | None |
| A0A4Y7IKX2 | 3-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.