DPCstruct | MC5246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0567 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416GX40 | 17-147 | ILGGLMAAAAYKTDAEEAVPIEIKRNGAVVLSFRIRPMGEDEYLKCKKDNTNYKRNKQLGTRVAESVDAARYRAQLIYEATVEEDRD… |
| A0A7X5D8E0 | 36-179 | EEILQNEDEMIAGLLEAAAFKKDDNLQKKIEIRRNGKLLFSFFVRPLTEEEIQGCRKKATKRRPDPRGKQFGMIDVETDVIKLRSYK… |
| N1ZQW2 | 17-113 | None |
| A0A0M0SYE4 | 2-138 | None |
| A0A5S9MGT6 | 2-112 | None |
| A0A0L0WEZ8 | 5-135 | None |
| A0A381IAC4 | 11-141 | None |
| U2SNN3 | 42-172 | None |
| A0A7U0WAG3 | 9-124 | None |
| R7B9F9 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.