DPCstruct | MC52458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 216 ± 19 aa |
| Standard deviation of domain lengths | 18.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1C407 | 1-215 | MKKILFLTFGVLITTNIFAQRASCDLIQPITFAENQNIYRFVAKQTAYKPLISARKQTKYKKNFFQHFFSPWKISRFGFTKSAASYR… |
| T2S9W7 | 15-192 | CVKKDLALKDLSLPQEASSYLASPQNSGNNGNSANRIDPQALRESLKESYLKAWYSPWLDAKVKSNKKEVFWILKEMNKSTGYGEDL… |
| A0A124FER9 | 1-204 | None |
| A0A2N6F078 | 6-228 | None |
| A0A7C1HQC4 | 1-207 | None |
| A0A1B4G269 | 20-253 | None |
| A0A3B9SFP4 | 1-214 | None |
| W4S5K4 | 4-207 | None |
| A0A1G4W154 | 462-711 | None |
| A0A7X9QBE7 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.