DPCstruct | MC5245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S3WQ43 | 9-136 | QIAAGDHPQPHPCCSRAFEIASAHLPEEDWADLQTLVEDADTALLHFECFTLPDSDAIGFKLLSTPWTDHHLGQFWGYDLSTLQALQ… |
| A0A7X5D2U8 | 18-115 | REAGETDGFPEISHVITISTEHIRPETASLLDADAVELIVWKKDKYGYVVMTIGWELYGEDIPEDLRACVQYAAEHNCDWLCLDGDA… |
| A0A1I7FML3 | 1-88 | None |
| A0A3A6Q824 | 61-164 | None |
| A0A1L3T006 | 77-164 | None |
| A0A318KZ60 | 59-149 | None |
| A0A2N4UPZ6 | 5-116 | None |
| Q7NYQ9 | 7-106 | None |
| A0A370L9S6 | 50-189 | None |
| A0A7C1QTP7 | 211-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.